Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein TRIQK (C8orf83)

This Recombinant Human Protein TRIQK (C8orf83) spans the amino acid sequence from region 1-86.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein homolog

UniProt

Q629K1

Expression Region

1-86

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRKDAATIKLPVDQYRKQIGKQDYKKTKPILRATKLKAEAKKTAIGIKEVGLVLAAILA LLLAFYAFFYLRLTTDVDPDLDQDED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00344 Protein Vector (Human) (pPM-C-His)
PV091441 500 ng

LINC00344 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-Hu CD43 FITC
MBS1801254-01 100 Tests

Anti-Hu CD43 FITC

Sign In for Pricing
View Details
Anti-Hu CD43 FITC
MBS1801254-02 5x 100 Tests

Anti-Hu CD43 FITC

Sign In for Pricing
View Details
POLR2L Polyclonal Antibody
RD84101A-01 60μL

POLR2L Polyclonal Antibody

Sign In for Pricing
View Details
POLR2L Polyclonal Antibody
RD84101A-02 120μL

POLR2L Polyclonal Antibody

Sign In for Pricing
View Details
POLR2L Polyclonal Antibody
RD84101A-03 200μL

POLR2L Polyclonal Antibody

Sign In for Pricing
View Details