Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Bladder cancer-associated protein (blcap)

This Recombinant Danio rerio Bladder cancer-associated protein (blcap) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, ZfBc10

UniProt

Q9IB61

Expression Region

1-87

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFNHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCHDSPLPDSAHDPSIVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1 beta (ARNT) (NM_001286036) Human Tagged ORF Clone
RC239562 10 µg

HIF1 beta (ARNT) (NM_001286036) Human Tagged ORF Clone

Sign In for Pricing
View Details
PKIB ORF Vector (Human) (pORF)
ORF007878 1.0 µg DNA

PKIB ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein P (S100P) ELISA Kit
MBS9714422-01 48 Tests

Human S100 Calcium Binding Protein P (S100P) ELISA Kit

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein P (S100P) ELISA Kit
MBS9714422-02 96 Tests

Human S100 Calcium Binding Protein P (S100P) ELISA Kit

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein P (S100P) ELISA Kit
MBS9714422-03 5x 96 Tests

Human S100 Calcium Binding Protein P (S100P) ELISA Kit

Sign In for Pricing
View Details
Rat Peroxiredoxin 2, PRDX2 ELISA KIT
E1633Ra-01 48 Well

Rat Peroxiredoxin 2, PRDX2 ELISA KIT

Sign In for Pricing
View Details