Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Bladder cancer-associated protein (blcap)

This Recombinant Danio rerio Bladder cancer-associated protein (blcap) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, ZfBc10

UniProt

Q9IB61

Expression Region

1-87

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFNHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCHDSPLPDSAHDPSIVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr455 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV634440 1.0 µg DNA

Olr455 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Pseudoerythromycin A enol ether
orb1692938-01 1 mg

Pseudoerythromycin A enol ether

Sign In for Pricing
View Details
Pseudoerythromycin A enol ether
orb1692938-02 5 mg

Pseudoerythromycin A enol ether

Sign In for Pricing
View Details
Mouse Jdp2 (NM_030887) AAV Particle
MR201300A1V 250 µL

Mouse Jdp2 (NM_030887) AAV Particle

Sign In for Pricing
View Details
Recombinant Geobacter metallireducens SsrA-binding protein (smpB)
MBS1349207-01 0.02 mg (E-Coli)

Recombinant Geobacter metallireducens SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Geobacter metallireducens SsrA-binding protein (smpB)
MBS1349207-02 0.1 mg (E-Coli)

Recombinant Geobacter metallireducens SsrA-binding protein (smpB)

Sign In for Pricing
View Details