Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Bladder cancer-associated protein (blcap)

This Recombinant Danio rerio Bladder cancer-associated protein (blcap) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, ZfBc10

UniProt

Q9IB61

Expression Region

1-87

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFNHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCHDSPLPDSAHDPSIVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEX37 Rabbit Polyclonal Antibody
orb1880862-01 30 µL

TEX37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TEX37 Rabbit Polyclonal Antibody
orb1880862-02 50 µL

TEX37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TEX37 Rabbit Polyclonal Antibody
orb1880862-03 100 µL

TEX37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TEX37 Rabbit Polyclonal Antibody
orb1880862-04 200 µL

TEX37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCNT1 (Cyclin T1, Cyclin-T1, CycT1, Cyclin-T)
124485 50 µg

CCNT1 (Cyclin T1, Cyclin-T1, CycT1, Cyclin-T)

Sign In for Pricing
View Details
Recombinant Human TFF2
HEOPP-2010 5 µg

Recombinant Human TFF2

Sign In for Pricing
View Details