Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein L2 (L2R)

This Recombinant Vaccinia virus Protein L2 (L2R) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Protein L2

UniProt

P20843

Expression Region

1-87

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVIADRLDDIVKQNIADEKFVDFVIHGLEHQCPAILRPLIRLFIDILLFVIVIYIFTVR LVSRNYQMLLALVALVITLTIFYYFIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF647 conjugate, 0.1mg/mL
BNC470164-500 1x 500 µL

CD28 (204.12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF647 conjugate, 0.1mg/mL
BNC472968-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF488A conjugate, 0.1mg/mL
BNC882345-100 1x 100 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), CF647 conjugate, 0.1mg/mL
BNC472174-500 1x 500 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdc20 (CDC20/1102), CF594 conjugate, 0.1mg/mL
BNC941102-500 1x 500 µL

Cdc20 (CDC20/1102), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details