Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter carbinolicus ATP synthase subunit c 2 (atpE2)

This Recombinant Pelobacter carbinolicus ATP synthase subunit c 2 (atpE2) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

ATP synthase subunit c 2, ATP synthase F (0) sector subunit c 2, F-type ATPase subunit c 2, F-ATPase subunit c 2, Lipid-binding protein 2

UniProt

Q3A602

Expression Region

1-88

Origin

Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFFSWVMITAGFGMAIGSLGTGIGQGLAVKSALEGVARNPGASGKILTTMMIGLAMIES LAIYVFVVAMIILFANPFQDVVLELLAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX8 Recombinant Mouse Monoclonal Antibody [6G5-R]
HA601270 100 µL

PAX8 Recombinant Mouse Monoclonal Antibody [6G5-R]

Sign In for Pricing
View Details
S6K1 (RPS6KB1) pSer434 Rabbit Polyclonal Antibody
AP20852PU-N 100 µg

S6K1 (RPS6KB1) pSer434 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNAI2 Antibody
KC-45036-01 50 μL

DNAI2 Antibody

Sign In for Pricing
View Details
DNAI2 Antibody
KC-45036-02 100 µL

DNAI2 Antibody

Sign In for Pricing
View Details
DNAI2 Antibody
KC-45036-03 1 mL

DNAI2 Antibody

Sign In for Pricing
View Details
CHRAC1 Rabbit Polyclonal Antibody
TA374760 100 µL

CHRAC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details