Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter carbinolicus ATP synthase subunit c 2 (atpE2)

This Recombinant Pelobacter carbinolicus ATP synthase subunit c 2 (atpE2) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

ATP synthase subunit c 2, ATP synthase F (0) sector subunit c 2, F-type ATPase subunit c 2, F-ATPase subunit c 2, Lipid-binding protein 2

UniProt

Q3A602

Expression Region

1-88

Origin

Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFFSWVMITAGFGMAIGSLGTGIGQGLAVKSALEGVARNPGASGKILTTMMIGLAMIES LAIYVFVVAMIILFANPFQDVVLELLAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF568 conjugate, 0.1mg/mL
BNC683017-100 1x 100 µL

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR562911 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
NTMT2 Human Gene Knockout Kit (CRISPR)
KN427679 1 Kit

NTMT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(S)-2-(Benzyloxy)propan-1-ol
TRC-B287723-250MG 250 mg

(S)-2-(Benzyloxy)propan-1-ol

Sign In for Pricing
View Details
A26B1 Antibody
8C17977-AAT 50 µg

A26B1 Antibody

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSV1/1934), CF488A conjugate, 0.1mg/mL
BNC881934-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (HSV1/1934), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details