Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat coronavirus Envelope small membrane protein (E)

This Recombinant Rat coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q9IKC8

Expression Region

1-88

Origin

Rat coronavirus (strain 681) (RCV-SDAV) (Sialodacryoadenitis virus SDAV-681)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTLLLSPSIYVYN RSKQLYKYYNEEVRPPPLEVDDIIIQTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Four And A Half LIM Domains Protein 2 (FHL2) ELISA Kit (Ready to Use)
orb3032593-01 48 Tests

Human Four And A Half LIM Domains Protein 2 (FHL2) ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human Four And A Half LIM Domains Protein 2 (FHL2) ELISA Kit (Ready to Use)
orb3032593-02 96 Tests

Human Four And A Half LIM Domains Protein 2 (FHL2) ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Hsa-miR-6504-5p miRNA Agomir
orb1919564-01 5 nmol

Hsa-miR-6504-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-6504-5p miRNA Agomir
orb1919564-02 10 nmol

Hsa-miR-6504-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-6504-5p miRNA Agomir
orb1919564-03 20 nmol

Hsa-miR-6504-5p miRNA Agomir

Sign In for Pricing
View Details
TERF2IP Antibody
orb1925771-01 50 µL

TERF2IP Antibody

Sign In for Pricing
View Details