Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter propionicus ATP synthase subunit c 2 (atpE2)

This Recombinant Pelobacter propionicus ATP synthase subunit c 2 (atpE2) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

ATP synthase subunit c 2, ATP synthase F (0) sector subunit c 2, F-type ATPase subunit c 2, F-ATPase subunit c 2, Lipid-binding protein 2

UniProt

A1AP46

Expression Region

1-91

Origin

Pelobacter propionicus (strain DSM 2379)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFFSMCVLGAAIGMAIGTLGTGIGQGLAVKSAVEGVSRNPGASGKIMTTMMIGLAMIES LAIYALVICLIILFANPYKDIALKLAETVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFA1 (Neutrophil Defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, DEF1, DEFA2, MRS, DEFA1B) (MaxLight 550)
MBS6211120-01 0.1 mL

DEFA1 (Neutrophil Defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, DEF1, DEFA2, MRS, DEFA1B) (MaxLight 550)

Sign In for Pricing
View Details
DEFA1 (Neutrophil Defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, DEF1, DEFA2, MRS, DEFA1B) (MaxLight 550)
MBS6211120-02 5x 0.1 mL

DEFA1 (Neutrophil Defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, DEF1, DEFA2, MRS, DEFA1B) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Aicda Pre-designed siRNA Set A
SI100439A 1 Each

Mouse Aicda Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal KA1/GRIK4/Glutamate Receptor KA1 Antibody [PerCP]
NBP1-76852PCP 0.1 mL

Rabbit Polyclonal KA1/GRIK4/Glutamate Receptor KA1 Antibody [PerCP]

Sign In for Pricing
View Details
PTGDR antibody
70R-10287 100 µL

PTGDR antibody

Sign In for Pricing
View Details
Gm14085 Recombinant Protein (Mouse)
RP137330 100 µg

Gm14085 Recombinant Protein (Mouse)

Sign In for Pricing
View Details