Recombinant Pelobacter propionicus ATP synthase subunit c 2 (atpE2)
This Recombinant Pelobacter propionicus ATP synthase subunit c 2 (atpE2) spans the amino acid sequence from region 1-91.
Product Specifications
Product Name Alternative
ATP synthase subunit c 2, ATP synthase F (0) sector subunit c 2, F-type ATPase subunit c 2, F-ATPase subunit c 2, Lipid-binding protein 2
UniProt
A1AP46
Expression Region
1-91
Origin
Pelobacter propionicus (strain DSM 2379)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSFFSMCVLGAAIGMAIGTLGTGIGQGLAVKSAVEGVSRNPGASGKIMTTMMIGLAMIES LAIYALVICLIILFANPYKDIALKLAETVAK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
