Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2352 (AF_2352)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2352 (AF_2352) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2352

UniProt

O30318

Expression Region

1-91

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSTFFKYSVLLLPALINLAAFLTNFQTNTLPVEPINLYLSNFVHSDFYHLTGNIVVYIV SAFLSFIFFRNSDMKGFSGYLLPSYSFLYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CHCHD3 activation kit by CRISPRa
GA110376 1 Kit

Human CHCHD3 activation kit by CRISPRa

Sign In for Pricing
View Details
Trpv6 Mouse Gene Knockout Kit (CRISPR)
KN518313 1 Kit

Trpv6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EN2 Antibody
OC-515-01 50 μL

EN2 Antibody

Sign In for Pricing
View Details
EN2 Antibody
OC-515-02 100 µL

EN2 Antibody

Sign In for Pricing
View Details
EN2 Antibody
OC-515-03 1 mL

EN2 Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (K8.8), CF594 conjugate, 0.1mg/mL
BNC940689-500 1x 500 µL

Cytokeratin 8 (K8.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details