Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2352 (AF_2352)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2352 (AF_2352) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2352

UniProt

O30318

Expression Region

1-91

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSTFFKYSVLLLPALINLAAFLTNFQTNTLPVEPINLYLSNFVHSDFYHLTGNIVVYIV SAFLSFIFFRNSDMKGFSGYLLPSYSFLYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF329 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F2]
TA809584AM 100 µL

ZNF329 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F2]

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (C-term) Rabbit Polyclonal Antibody
AP31048PU-N 250 µL

Cytokeratin 14 (KRT14) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike Trimer Protein, His Tag (BJ.1/Omicron) (MALS verified)
SPN-C522u-50ug 50 µg

SARS-CoV-2 Spike Trimer Protein, His Tag (BJ.1/Omicron) (MALS verified)

Sign In for Pricing
View Details
Tissue FFPE Sections, Seminal vesicle
CS800475 5x 5 µm

Tissue FFPE Sections, Seminal vesicle

Sign In for Pricing
View Details
FADD Recombinant Rabbit monoclonal Antibody
HA751190 100 µL

FADD Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound)
AAF-007-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound)

Sign In for Pricing
View Details