Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium urealyticum UPF0233 membrane protein cu0052 (cu0052)

This Recombinant Corynebacterium urealyticum UPF0233 membrane protein cu0052 (cu0052) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

UPF0233 membrane protein cu0052

UniProt

B1VE23

Expression Region

1-92

Origin

Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKSKINSPEENFDSSAAAGVDRRTPVKLNASGTPRWYIVIMLGLMLLGLAWLVVNYIAG PAIPLMVTLGPWNYLIGFGLFIVGLLMTMGWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-100 1x 100 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF640R conjugate, 0.1mg/mL
BNC400193-500 1x 500 µL

CD86 (BU63), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-100 1x 100 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details