Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqhV (yqhV)

This Recombinant Bacillus subtilis Uncharacterized protein yqhV (yqhV) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Uncharacterized protein yqhV

UniProt

P49779

Expression Region

1-93

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFLLGNINSTVLTMAGLRVLSSMIELTAAIVMLVTNDVRKAVVVNSILAIVGPLIFIIT MTVGIYQIAGQLSYAKLILIFTGVVLILAGVHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R/S)-N-Deacetyl Colchiceine N-Trifluroracetate
TRC-D198905-50MG 50 mg

(R/S)-N-Deacetyl Colchiceine N-Trifluroracetate

Sign In for Pricing
View Details
Anti-LUX | Transcription factor LUX
AS16 4106 50 µg

Anti-LUX | Transcription factor LUX

Sign In for Pricing
View Details
Ephrin B1 (EFNB1) (NM_004429) Human Over-expression Lysate
LY401409 100 µg

Ephrin B1 (EFNB1) (NM_004429) Human Over-expression Lysate

Sign In for Pricing
View Details
Urolithin A Glucuronide
TRC-U847070-2.5MG 2.5 mg

Urolithin A Glucuronide

Sign In for Pricing
View Details
Human Complement C3 Recombinant Rabbit monoclonal Antibody
HA725141 100 µL

Human Complement C3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Melanoma Marker (KBA.62), CF405S conjugate, 0.1mg/mL
BNC040895-500 1x 500 µL

Melanoma Marker (KBA.62), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details