Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0110 (MJ0110)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0110 (MJ0110) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0110

UniProt

Q57574

Expression Region

1-93

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVINMDFDITVIGYIAGTLTTFASLPQLIKSLKEKDMSNISLAFVITFTTGLTLWLIYGI LRNDYPIIVFNILSLMFWIPITYLKIRDEMRKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camk2d siRNA Oligos set (Rat)
14959176 3x 5 nmol

Camk2d siRNA Oligos set (Rat)

Sign In for Pricing
View Details
OR5AK2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1515404 1.0 µg DNA

OR5AK2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Isogomisin O
380537 5 mg

Isogomisin O

Sign In for Pricing
View Details
TADA1L (TADA1) (NM_053053) Human Over-expression Lysate
LS117143 100 µg

TADA1L (TADA1) (NM_053053) Human Over-expression Lysate

Sign In for Pricing
View Details
GTP sodium solution
HBP002000 200 µL

GTP sodium solution

Sign In for Pricing
View Details
Human Cytoplasmic Antiproteinase 2 (CAP2) ELISA Kit
201-12-3602 96 Tests

Human Cytoplasmic Antiproteinase 2 (CAP2) ELISA Kit

Sign In for Pricing
View Details