Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0110 (MJ0110)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0110 (MJ0110) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0110

UniProt

Q57574

Expression Region

1-93

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVINMDFDITVIGYIAGTLTTFASLPQLIKSLKEKDMSNISLAFVITFTTGLTLWLIYGI LRNDYPIIVFNILSLMFWIPITYLKIRDEMRKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

New Methylene Blue N discontinued. See 240915
285813-01 10 g

New Methylene Blue N discontinued. See 240915

Sign In for Pricing
View Details
New Methylene Blue N discontinued. See 240915
285813-02 25 g

New Methylene Blue N discontinued. See 240915

Sign In for Pricing
View Details
CHSY1 CRISPR/Cas9 KO Plasmid (m)
sc-435385 20 µg

CHSY1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
ALKBH2 Protein Vector (Human) (pPM-N-D-C-HA)
PV321324 500 ng

ALKBH2 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
CYB5A, 1-108aa, Human, His tag, E.coli
E53A01803 50 µg

CYB5A, 1-108aa, Human, His tag, E.coli

Sign In for Pricing
View Details
FGF-16 (G-2) AC
sc-390547 AC 500 µg/mL - 25% ag

FGF-16 (G-2) AC

Sign In for Pricing
View Details