Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0110 (MJ0110)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0110 (MJ0110) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0110

UniProt

Q57574

Expression Region

1-93

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVINMDFDITVIGYIAGTLTTFASLPQLIKSLKEKDMSNISLAFVITFTTGLTLWLIYGI LRNDYPIIVFNILSLMFWIPITYLKIRDEMRKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD20/MS4A1 Antibody (2H7), PerCP
FHC90744 100 Tests

Anti-Human CD20/MS4A1 Antibody (2H7), PerCP

Sign In for Pricing
View Details
OR13C7P Recombinant Protein (Human)
RP079605 100 µg

OR13C7P Recombinant Protein (Human)

Sign In for Pricing
View Details
LOC652956 ORF Vector (Rat) (pORF)
ORF069756 1.0 µg DNA

LOC652956 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CD20 (93-1B3), Biotin conjugate, 0.1mg/mL
BNCB1047-100 1x 100 µL

CD20 (93-1B3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Stard4 (NM_133774) Mouse Tagged ORF Clone
MR202623 10 µg

Stard4 (NM_133774) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Macaca mulatta C-C chemokine receptor-like 2 (CCRL2)
orb2905565-01 20 µg

Recombinant Macaca mulatta C-C chemokine receptor-like 2 (CCRL2)

Sign In for Pricing
View Details