Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0110 (MJ0110)
This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0110 (MJ0110) spans the amino acid sequence from region 1-93.
Product Specifications
Product Name Alternative
Uncharacterized protein MJ0110
UniProt
Q57574
Expression Region
1-93
Origin
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVINMDFDITVIGYIAGTLTTFASLPQLIKSLKEKDMSNISLAFVITFTTGLTLWLIYGI LRNDYPIIVFNILSLMFWIPITYLKIRDEMRKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6296456-01 0.1 mL
ERF, CT (ERF, ETS domain-containing transcription factor ERF, Ets2 repressor factor, PE-2) (MaxLight 650)
Sign In for Pricing
View Details MBS6296456-02 5x 0.1 mL
ERF, CT (ERF, ETS domain-containing transcription factor ERF, Ets2 repressor factor, PE-2) (MaxLight 650)
Sign In for Pricing
View Details K2347108 1.0 µg DNA
TCEAL5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details