Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A8C8J5

Expression Region

1-94

Origin

Influenza A virus (strain A/USA:Texas/UR06-0195/2007 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LTEVETPIRNEWGCRCNDSSDPLVVAASIIGIVHLILWIIDRLFSKSIYRIFKHGLKRGP STEGVPESMREEYREEQQNAVDADDDHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Hexadecyl-octadecanoic Acid Ethyl Ester
TRC-H293815-2.5G 2.5 g

2-Hexadecyl-octadecanoic Acid Ethyl Ester

Sign In for Pricing
View Details
Recombinant Porcine Interleuikin-8 (1-72) (CXCL8)
7-01909 2 µg

Recombinant Porcine Interleuikin-8 (1-72) (CXCL8)

Sign In for Pricing
View Details
Mouse Monoclonal Zebrafish Gut Absorptive Cell Epitopes Antibody (FIS 4B7/1) [DyLight 650]
NBP2-50373C 0.1 mL

Mouse Monoclonal Zebrafish Gut Absorptive Cell Epitopes Antibody (FIS 4B7/1) [DyLight 650]

Sign In for Pricing
View Details
Guinea pig Coatomer subunit delta (ARCN1) ELISA Kit
MBS7240055-01 48 Well

Guinea pig Coatomer subunit delta (ARCN1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Coatomer subunit delta (ARCN1) ELISA Kit
MBS7240055-02 96 Well

Guinea pig Coatomer subunit delta (ARCN1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Coatomer subunit delta (ARCN1) ELISA Kit
MBS7240055-03 5x 96 Well

Guinea pig Coatomer subunit delta (ARCN1) ELISA Kit

Sign In for Pricing
View Details