Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A8C8J5

Expression Region

1-94

Origin

Influenza A virus (strain A/USA:Texas/UR06-0195/2007 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LTEVETPIRNEWGCRCNDSSDPLVVAASIIGIVHLILWIIDRLFSKSIYRIFKHGLKRGP STEGVPESMREEYREEQQNAVDADDDHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3849607 1.0 µg DNA

Kcnb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Monoclonal IBRDC2 Antibody (OTI9H10) [Alexa Fluor 405]
NBP2-72470AF405 0.1 mL

Mouse Monoclonal IBRDC2 Antibody (OTI9H10) [Alexa Fluor 405]

Sign In for Pricing
View Details
Recombinant Human ASC/TMS1/PYCARD Protein, N-His
orb2834703-01 20 µg

Recombinant Human ASC/TMS1/PYCARD Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ASC/TMS1/PYCARD Protein, N-His
orb2834703-02 50 µg

Recombinant Human ASC/TMS1/PYCARD Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ASC/TMS1/PYCARD Protein, N-His
orb2834703-03 100 µg

Recombinant Human ASC/TMS1/PYCARD Protein, N-His

Sign In for Pricing
View Details
EFEMP1 (NM_001039348) Human Untagged Clone
SC310892 10 µg

EFEMP1 (NM_001039348) Human Untagged Clone

Sign In for Pricing
View Details