Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A8C8J5

Expression Region

1-94

Origin

Influenza A virus (strain A/USA:Texas/UR06-0195/2007 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LTEVETPIRNEWGCRCNDSSDPLVVAASIIGIVHLILWIIDRLFSKSIYRIFKHGLKRGP STEGVPESMREEYREEQQNAVDADDDHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (MaxLight 550)
252067-ML550 100 µL

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (MaxLight 550)

Sign In for Pricing
View Details
Secretin (5 - 27), porcine
orb2694026-01 5 mg

Secretin (5 - 27), porcine

Sign In for Pricing
View Details
Secretin (5 - 27), porcine
orb2694026-02 10 mg

Secretin (5 - 27), porcine

Sign In for Pricing
View Details
Amitriptyline Hydrochloride
002616 1 g

Amitriptyline Hydrochloride

Sign In for Pricing
View Details
Rabbit Polyclonal MOBKL2C Antibody
NBP2-84168-0.1mL 0.1 mL

Rabbit Polyclonal MOBKL2C Antibody

Sign In for Pricing
View Details
Recombinant Thermotoga lettingae UPF0296 protein Tlet_1629 (Tlet_1629)
MBS1249585-01 0.02 mg (E-Coli)

Recombinant Thermotoga lettingae UPF0296 protein Tlet_1629 (Tlet_1629)

Sign In for Pricing
View Details