Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM1934 (PM1934)

This Recombinant Pasteurella multocida Uncharacterized protein PM1934 (PM1934) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

Uncharacterized protein PM1934

UniProt

Q9CJR0

Expression Region

1-94

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLTLSKNSPHFYKWIVLLLLKIARVFLSKGIRPLVIDSQKFTWYKHKCYQLPEIAQKIT LKHKLLSLYDGDIYNYLGLEDLLDITQQEESKTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A, Recombinant, His-Tag (Liquid) (Protein A beads, Protein A sepharose, Protein A Sepharose Beads) discontinued
220199 100 mg

Protein A, Recombinant, His-Tag (Liquid) (Protein A beads, Protein A sepharose, Protein A Sepharose Beads) discontinued

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 7B (WNT7B)
MBS2110852-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 7B (WNT7B)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 7B (WNT7B)
MBS2110852-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 7B (WNT7B)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 7B (WNT7B)
MBS2110852-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 7B (WNT7B)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 7B (WNT7B)
MBS2110852-04 1 mL

Cy3-Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 7B (WNT7B)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 7B (WNT7B)
MBS2110852-05 5 mL

Cy3-Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 7B (WNT7B)

Sign In for Pricing
View Details