Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM1934 (PM1934)

This Recombinant Pasteurella multocida Uncharacterized protein PM1934 (PM1934) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

Uncharacterized protein PM1934

UniProt

Q9CJR0

Expression Region

1-94

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLTLSKNSPHFYKWIVLLLLKIARVFLSKGIRPLVIDSQKFTWYKHKCYQLPEIAQKIT LKHKLLSLYDGDIYNYLGLEDLLDITQQEESKTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 Antibody
orb2641815 7 mL

CD99 Antibody

Sign In for Pricing
View Details
SHF rabbit pAb
RA29800-01 50 µL

SHF rabbit pAb

Sign In for Pricing
View Details
SHF rabbit pAb
RA29800-02 100 µL

SHF rabbit pAb

Sign In for Pricing
View Details
SB-743921 (free base)
HY-14661 1 Each

SB-743921 (free base)

Sign In for Pricing
View Details
Anti-FXYD6 Antibody (C-term)
A09541-400ul 400 µL

Anti-FXYD6 Antibody (C-term)

Sign In for Pricing
View Details
MED31 Rabbit Polyclonal Antibody (HRP)
orb2102672 100 µL

MED31 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details