Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Cobalt transport protein CbiN (cbiN)

This Recombinant Methanocaldococcus jannaschii Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

Q58490

Expression Region

1-95

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METKHIILLAIVAIIIALPLIIYAGKGEEEGYFGGSDDQGCEVVEELGYKPWFHPIWEPP SGEIESLLFALQAAIGAIIIGYYIGYYNAKRQVAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL39P34 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1993107 1.0 µg DNA

RPL39P34 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-Polypyrimidine Tract Binding Protein 1 (PTBP1) Polyclonal Antibody
TRV-0020896-01 50 Tests

Anti-Polypyrimidine Tract Binding Protein 1 (PTBP1) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Polypyrimidine Tract Binding Protein 1 (PTBP1) Polyclonal Antibody
TRV-0020896-02 100 Tests

Anti-Polypyrimidine Tract Binding Protein 1 (PTBP1) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Polypyrimidine Tract Binding Protein 1 (PTBP1) Polyclonal Antibody
TRV-0020896-03 200 Tests

Anti-Polypyrimidine Tract Binding Protein 1 (PTBP1) Polyclonal Antibody

Sign In for Pricing
View Details
FBXL17 (NM_022824) Human Over-expression Lysate
LH11797V 100 µg

FBXL17 (NM_022824) Human Over-expression Lysate

Sign In for Pricing
View Details
YTHDF2 (NM_016258) Human Over-expression Lysate
LY414098 100 µg

YTHDF2 (NM_016258) Human Over-expression Lysate

Sign In for Pricing
View Details