Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Cobalt transport protein CbiN (cbiN)

This Recombinant Methanocaldococcus jannaschii Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

Q58490

Expression Region

1-95

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METKHIILLAIVAIIIALPLIIYAGKGEEEGYFGGSDDQGCEVVEELGYKPWFHPIWEPP SGEIESLLFALQAAIGAIIIGYYIGYYNAKRQVAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNASE12 Human qPCR Primer Pair (NM_001024822)
HP202717 200 Reactions

RNASE12 Human qPCR Primer Pair (NM_001024822)

Sign In for Pricing
View Details
Adracalin (AAAS) (NM_015665) Human Recombinant Protein
TP762066 50 µg

Adracalin (AAAS) (NM_015665) Human Recombinant Protein

Sign In for Pricing
View Details
PERM1 Antibody Blocking Peptide
orb1511983 500 µg

PERM1 Antibody Blocking Peptide

Sign In for Pricing
View Details
Cleaved-CASP3 (D175) Antibody
CSB-PA000022-01 50 µg

Cleaved-CASP3 (D175) Antibody

Sign In for Pricing
View Details
Cleaved-CASP3 (D175) Antibody
CSB-PA000022-02 100 µg

Cleaved-CASP3 (D175) Antibody

Sign In for Pricing
View Details
Silicon nanopowder, 99%
GX8061-100g 100 g

Silicon nanopowder, 99%

Sign In for Pricing
View Details