Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3)

This Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Probable dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Manno

UniProt

Q9XVV5

Expression Region

1-95

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSQLVTYSAHVILFVLVWLLAYTDVVPVLSYLPECLHCLVNYAPFFAVLFLGIYAVFNV VYGVATFNDCAEAKVELLGEIKEAREELKRKRIID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ Red 780 SE
1191-AAT 1 mg

MFluor™ Red 780 SE

Sign In for Pricing
View Details
KRT26 (N-term) Rabbit Polyclonal Antibody
AP52414PU-N 400 µL

KRT26 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ketohexokinase Recombinant Rabbit monoclonal Antibody
HA750859 100 µL

Ketohexokinase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PhosphoWorks™ Luminometric ATP Assay Kit *Extended Luminescence*
21609-AAT 1 Plate

PhosphoWorks™ Luminometric ATP Assay Kit *Extended Luminescence*

Sign In for Pricing
View Details
Ugt1a7c Mouse Gene Knockout Kit (CRISPR)
KN518669 1 Kit

Ugt1a7c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS626751 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details