Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3)

This Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Probable dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Manno

UniProt

Q9XVV5

Expression Region

1-95

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSQLVTYSAHVILFVLVWLLAYTDVVPVLSYLPECLHCLVNYAPFFAVLFLGIYAVFNV VYGVATFNDCAEAKVELLGEIKEAREELKRKRIID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olig1 Mouse Monoclonal Antibody [Clone ID: N149/25]
75-180 100 µL

Olig1 Mouse Monoclonal Antibody [Clone ID: N149/25]

Sign In for Pricing
View Details
Zdhhc7 Mouse Gene Knockout Kit (CRISPR)
KN519695 1 Kit

Zdhhc7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pure Goat Anti-Mouse IgG Gel Specific Immobilized Antibodies
AG-004-2 2 mL

Pure Goat Anti-Mouse IgG Gel Specific Immobilized Antibodies

Sign In for Pricing
View Details
MEK3 (MAP2K3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D3]
TA505671AM 100 µL

MEK3 (MAP2K3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D3]

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF594 conjugate, 0.1mg/mL
BNC941855-100 1x 100 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®498 Donkey Anti-Mouse IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
#20994-50uL 1x 50 µL

CF®498 Donkey Anti-Mouse IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL

Sign In for Pricing
View Details