Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3)

This Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Probable dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Manno

UniProt

Q9XVV5

Expression Region

1-95

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSQLVTYSAHVILFVLVWLLAYTDVVPVLSYLPECLHCLVNYAPFFAVLFLGIYAVFNV VYGVATFNDCAEAKVELLGEIKEAREELKRKRIID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Oxopentanal
TRC-O858605-250MG 250 mg

4-Oxopentanal

Sign In for Pricing
View Details
CD40 (NM_001302753) Human Tagged ORF Clone
RG236813 10 µg

CD40 (NM_001302753) Human Tagged ORF Clone

Sign In for Pricing
View Details
4-[(3S)-3-[[(1R)-1-(1-Naphthalenyl)ethyl]amino]-1-pyrrolidinyl]benzeneacetic Acid
TRC-N345665-10MG 10 mg

4-[(3S)-3-[[(1R)-1-(1-Naphthalenyl)ethyl]amino]-1-pyrrolidinyl]benzeneacetic Acid

Sign In for Pricing
View Details
Potassium 2-(oxiran-2-yl)ethyltrifluoroborate
TRC-P993880-5MG 5 mg

Potassium 2-(oxiran-2-yl)ethyltrifluoroborate

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2446), CF488A conjugate, 0.1mg/mL
BNC882446-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2446), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227US-01 25 µg

Elab Fluor® Red 780 Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details