Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q4L562

Expression Region

1-96

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIVKHTVGFIASIVLTLLAVFVTLYTNMTFHAKTTIIFGFAFIQAAVQLLMFMHLTEG KDGQVQSFKVIFAIIITLVTVIGTYWVMQGGHSHHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSGR (OR51E2) (NM_030774) Human Over-expression Lysate
LS081285-100ug 100 µg

PSGR (OR51E2) (NM_030774) Human Over-expression Lysate

Sign In for Pricing
View Details
SEPT8 (Septin 8, Septin-8, KIAA0202) APC
MBS6138978-01 0.1 mL

SEPT8 (Septin 8, Septin-8, KIAA0202) APC

Sign In for Pricing
View Details
SEPT8 (Septin 8, Septin-8, KIAA0202) APC
MBS6138978-02 5x 0.1 mL

SEPT8 (Septin 8, Septin-8, KIAA0202) APC

Sign In for Pricing
View Details
Box of 100 Pes Membranes 0.80 µm, 47 Mm
MF047PE080C Box of 100

Box of 100 Pes Membranes 0.80 µm, 47 Mm

Sign In for Pricing
View Details
Rabbit Polyclonal AHNAK Antibody (Human)
B2020350 100 µL

Rabbit Polyclonal AHNAK Antibody (Human)

Sign In for Pricing
View Details
3-Iodophenylacetic acid
sc-226104 1 g

3-Iodophenylacetic acid

Sign In for Pricing
View Details