Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q4L562

Expression Region

1-96

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIVKHTVGFIASIVLTLLAVFVTLYTNMTFHAKTTIIFGFAFIQAAVQLLMFMHLTEG KDGQVQSFKVIFAIIITLVTVIGTYWVMQGGHSHHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP3M2 (Biotin)
555207-01 50 µg

AP3M2 (Biotin)

Sign In for Pricing
View Details
AP3M2 (Biotin)
555207-02 100 µg

AP3M2 (Biotin)

Sign In for Pricing
View Details
EEF1D (NM_001130054) Human 3' UTR Clone
SC200298 10 µg

EEF1D (NM_001130054) Human 3' UTR Clone

Sign In for Pricing
View Details
Nucleophosmin Polyclonal Antibody, FITC Conjugated
bs-4757R-FITC-01 20 µL

Nucleophosmin Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Nucleophosmin Polyclonal Antibody, FITC Conjugated
bs-4757R-FITC-02 100 µL

Nucleophosmin Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
ADI1, ID (ADI1, MTCBP1, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase, Acireductone dioxygenase (Fe (2+) -requiring), Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1, Submergence-induced protein-like factor) (Biotin) discontinued
031642-Biotin 200 µL

ADI1, ID (ADI1, MTCBP1, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase, Acireductone dioxygenase (Fe (2+) -requiring), Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1, Submergence-induced protein-like factor) (Biotin) discontinued

Sign In for Pricing
View Details