Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C2M3

Expression Region

1-96

Origin

Influenza A virus (strain A/Memphis/101/1972 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Nectin-4/PVRL4 Antibody (337516) [Janelia Fluor 635]
FAB2659JF635 0.1 mL

Mouse Monoclonal Nectin-4/PVRL4 Antibody (337516) [Janelia Fluor 635]

Sign In for Pricing
View Details
Cdc42bpg (NM_001033342) Mouse Tagged Lenti ORF Clone
MR216620L3 10 µg

Cdc42bpg (NM_001033342) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Monoclonal Rae-1 epsilon Antibody (205001) [DyLight 680]
FAB1135Y 0.1 mL

Rat Monoclonal Rae-1 epsilon Antibody (205001) [DyLight 680]

Sign In for Pricing
View Details
Rabbit Anti-MYH-pan/MYH1 Polyclonal Antibody
PAV9155 100 μL

Rabbit Anti-MYH-pan/MYH1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-mouse Beta-defensin 14 polyclonal Antibody, HRP conjugated
MBS1490276-01 0.05 mg

Rabbit anti-mouse Beta-defensin 14 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-mouse Beta-defensin 14 polyclonal Antibody, HRP conjugated
MBS1490276-02 0.1 mg

Rabbit anti-mouse Beta-defensin 14 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details