Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C2M3

Expression Region

1-96

Origin

Influenza A virus (strain A/Memphis/101/1972 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cary Blair Transport Medium - Ready-to-Use - 1000mL
BZ448-01 100 mL

Cary Blair Transport Medium - Ready-to-Use - 1000mL

Sign In for Pricing
View Details
Cary Blair Transport Medium - Ready-to-Use - 1000mL
BZ448-02 200 mL

Cary Blair Transport Medium - Ready-to-Use - 1000mL

Sign In for Pricing
View Details
Cary Blair Transport Medium - Ready-to-Use - 1000mL
BZ448-03 500 mL

Cary Blair Transport Medium - Ready-to-Use - 1000mL

Sign In for Pricing
View Details
Cary Blair Transport Medium - Ready-to-Use - 1000mL
BZ448-04 1000 mL

Cary Blair Transport Medium - Ready-to-Use - 1000mL

Sign In for Pricing
View Details
TCF3 / E2A (TCF3) (NM_001136139) Human Tagged Lenti ORF Clone
RC227647L4 10 µg

TCF3 / E2A (TCF3) (NM_001136139) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SUV39H2 siRNA (Mouse)
CRM6333-01 15 nmol

SUV39H2 siRNA (Mouse)

Sign In for Pricing
View Details