Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C2M3

Expression Region

1-96

Origin

Influenza A virus (strain A/Memphis/101/1972 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR48 Rabbit Polyclonal Antibody (RBITC)
orb1011478 100 µL

GPR48 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Pigeon 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit
MBS9933796 Inquire

Pigeon 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit

Sign In for Pricing
View Details
F7 (Coagulation Factor VII (Serum prothrombin conversion accelerator) ) discontinued
245887 50 µL

F7 (Coagulation Factor VII (Serum prothrombin conversion accelerator) ) discontinued

Sign In for Pricing
View Details
Lnx1 (NM_010727) Mouse Untagged Clone
MC219803 10 µg

Lnx1 (NM_010727) Mouse Untagged Clone

Sign In for Pricing
View Details
Human CRYL1 shRNA Plasmid
abx959506-01 150 µg

Human CRYL1 shRNA Plasmid

Sign In for Pricing
View Details
Human CRYL1 shRNA Plasmid
abx959506-02 300 µg

Human CRYL1 shRNA Plasmid

Sign In for Pricing
View Details