Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1 spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit F1, Mnh complex subunit F1

UniProt

A6U054

Expression Region

1-97

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PAX9 Antibody
RC-15481-01 50 μL

Recombinant PAX9 Antibody

Sign In for Pricing
View Details
Recombinant PAX9 Antibody
RC-15481-02 100 µL

Recombinant PAX9 Antibody

Sign In for Pricing
View Details
Recombinant PAX9 Antibody
RC-15481-03 1 mL

Recombinant PAX9 Antibody

Sign In for Pricing
View Details
Cebpd Mouse Gene Knockout Kit (CRISPR)
KN503101 1 Kit

Cebpd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclin B2 (X29.2), CF740 conjugate, 0.1mg/mL
BNC743059-100 1x 100 µL

Cyclin B2 (X29.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSMD10 Polyclonal Antibody
E-AB-90421-01 60 µL

PSMD10 Polyclonal Antibody

Sign In for Pricing
View Details