Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit F1 spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit F1, Mnh complex subunit F1

UniProt

A6U054

Expression Region

1-97

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Cervix
CB502765 1 Block

Frozen Tissue Blocks, Cervix

Sign In for Pricing
View Details
FAM90A8P (NM_001164450) Human Over-expression Lysate
LY431409 100 µg

FAM90A8P (NM_001164450) Human Over-expression Lysate

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF647 conjugate, 0.1mg/mL
BNC472939-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
8-(2-Pyrimidinyl)-8-aza-5-azoniaspiro[4.5]decane Bromide
TRC-P997235-500MG 500 mg

8-(2-Pyrimidinyl)-8-aza-5-azoniaspiro[4.5]decane Bromide

Sign In for Pricing
View Details
Frataxin (Marker of Friedreich Ataxia) (FXN/2124), CF740 conjugate, 0.1mg/mL
BNC742190-100 1x 100 µL

Frataxin (Marker of Friedreich Ataxia) (FXN/2124), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cesium Chloride
TRC-C280000-50G 50 g

Cesium Chloride

Sign In for Pricing
View Details