Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q08IG9

Expression Region

1-97

Origin

Influenza A virus (strain A/Duck/Hokkaido/8/1980 H3N8)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 Rabbit Polyclonal Antibody
AP08083PU-S 50 µL

AKT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cell Meter™ VX500 fixable viability dye
22542-AAT 200 Tests

Cell Meter™ VX500 fixable viability dye

Sign In for Pricing
View Details
Elab Fluor® Red 780 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09753S-01 25 µg

Elab Fluor® Red 780 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09753S-02 100 µg

Elab Fluor® Red 780 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
HNF1 alpha Rabbit Polyclonal Antibody
HA500285 100 µL

HNF1 alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phenobarbital 1-Diethyl Butyrate
TRC-P316880-10MG 10 mg

Phenobarbital 1-Diethyl Butyrate

Sign In for Pricing
View Details