Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q08IG9

Expression Region

1-97

Origin

Influenza A virus (strain A/Duck/Hokkaido/8/1980 H3N8)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKS1 (CKS1B) (NM_001826) Human Over-expression Lysate
LY400692 100 µg

CKS1 (CKS1B) (NM_001826) Human Over-expression Lysate

Sign In for Pricing
View Details
Actr3 Mouse Gene Knockout Kit (CRISPR)
KN500792 1 Kit

Actr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MIR944 Human qPCR Primer Pair (MI0005769)
HP300627 200 Reactions

MIR944 Human qPCR Primer Pair (MI0005769)

Sign In for Pricing
View Details
TIS11B (ZFP36L1) Human Gene Knockout Kit (CRISPR)
KN402155 1 Kit

TIS11B (ZFP36L1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human robld3 (LAMTOR2) activation kit by CRISPRa
GA109167 1 Kit

Human robld3 (LAMTOR2) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800490 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details