Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q30NQ0

Expression Region

1-97

Origin

Influenza A virus (strain A/Beijing/39/1975 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRSEWECRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF594 conjugate, 0.1mg/mL
BNC941877-100 1x 100 µL

Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Formylglycinamide Ribotide (Technical Grade)
TRC-F700442-5MG 5 mg

Formylglycinamide Ribotide (Technical Grade)

Sign In for Pricing
View Details
ZNF583 Mouse Monoclonal Antibody [Clone ID: OTI4H2]
CF810527 100 µg

ZNF583 Mouse Monoclonal Antibody [Clone ID: OTI4H2]

Sign In for Pricing
View Details
VGLUT1 Recombinant Chimeric Antibody Antibody
HA601392 100 µL

VGLUT1 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
INOS Antibody
8C0251-AAT 50 µg

INOS Antibody

Sign In for Pricing
View Details
CLCN2 Human Gene Knockout Kit (CRISPR)
KN422621 1 Kit

CLCN2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details