Recombinant Influenza A virus Matrix protein 2 (M)
This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.
Product Specifications
Product Name Alternative
Matrix protein 2, Proton channel protein M2
UniProt
Q30NQ0
Expression Region
1-97
Origin
Influenza A virus (strain A/Beijing/39/1975 H3N2)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLLTEVETPIRSEWECRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682434-500 1x 500 µL
Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GP-1801-40 1 mL
Colloidal Gold Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-, 40nm
Sign In for Pricing
View Details 
