Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q30NQ0

Expression Region

1-97

Origin

Influenza A virus (strain A/Beijing/39/1975 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRSEWECRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RC3H2 activation kit by CRISPRa
GA110168 1 Kit

Human RC3H2 activation kit by CRISPRa

Sign In for Pricing
View Details
Perfluoroheptanoic Acid-13C
TRC-P286303-1MG 1 mg

Perfluoroheptanoic Acid-13C

Sign In for Pricing
View Details
4-Bromo-5H-dibenzo[a,d]cyclohepten-5-one
TRC-B684060-50MG 50 mg

4-Bromo-5H-dibenzo[a,d]cyclohepten-5-one

Sign In for Pricing
View Details
TOB (TOB1) (N-term) Rabbit Polyclonal Antibody
AP18225PU-N 400 µL

TOB (TOB1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human C17orf58 activation kit by CRISPRa
GA117084 1 Kit

Human C17orf58 activation kit by CRISPRa

Sign In for Pricing
View Details
MURF3 (TRIM54) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6C3]
TA803873AM 100 µL

MURF3 (TRIM54) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6C3]

Sign In for Pricing
View Details