Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67179

Expression Region

1-97

Origin

Influenza A virus (strain A/Korea/426/1968 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHFILWILDRLFFKCIYRFFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR55 Conjugated Antibody
C44970 100 µL

GPR55 Conjugated Antibody

Sign In for Pricing
View Details
PI3-kinase p110 subunit beta Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-52218R-BF750-01 20 µL

PI3-kinase p110 subunit beta Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
PI3-kinase p110 subunit beta Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-52218R-BF750-02 100 µL

PI3-kinase p110 subunit beta Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Mannan Binding Lectin Recombinant Rabbit mAb
orb2326379-01 25 µL

Mannan Binding Lectin Recombinant Rabbit mAb

Sign In for Pricing
View Details
Mannan Binding Lectin Recombinant Rabbit mAb
orb2326379-02 50 µL

Mannan Binding Lectin Recombinant Rabbit mAb

Sign In for Pricing
View Details
Mannan Binding Lectin Recombinant Rabbit mAb
orb2326379-03 100 µL

Mannan Binding Lectin Recombinant Rabbit mAb

Sign In for Pricing
View Details