Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77XR9

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/220/1997 H5N1 genotype Gs/Gd)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETLTRNGWGCRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (KRT8/803), CF405S conjugate, 0.1mg/mL
BNC040803-500 1x 500 µL

Cytokeratin 8 (KRT8/803), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTP kappa (PTPRK) Human Gene Knockout Kit (CRISPR)
KN417570 1 Kit

PTP kappa (PTPRK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5Beta-Epiandrosterone-d6
TRC-E578017-2.5MG 2.5 mg

5Beta-Epiandrosterone-d6

Sign In for Pricing
View Details
Amidosulfonic Acid
TRC-A576785-250G 250 g

Amidosulfonic Acid

Sign In for Pricing
View Details
DMDM Hydantoin
TRC-P688135-2.5G 2.5 g

DMDM Hydantoin

Sign In for Pricing
View Details
Iodoethane-1,1-d2 (Stabilized with Copper)
TRC-I705874-500MG 500 mg

Iodoethane-1,1-d2 (Stabilized with Copper)

Sign In for Pricing
View Details