Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77XR9

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/220/1997 H5N1 genotype Gs/Gd)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETLTRNGWGCRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3S,4E)-5-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-3-hydroxy-4-pentenoic acid Sodium
TRC-C661140-25MG 25 mg

(3S,4E)-5-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-3-hydroxy-4-pentenoic acid Sodium

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), CF594 conjugate, 0.1mg/mL
BNC942218-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CIKS (TRAF3IP2) Human Gene Knockout Kit (CRISPR)
KN401106 1 Kit

CIKS (TRAF3IP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alpha 1 Acid Glycoprotein Recombinant Rabbit Monoclonal Antibody [JE31-16]
HA721396 100 µL

Alpha 1 Acid Glycoprotein Recombinant Rabbit Monoclonal Antibody [JE31-16]

Sign In for Pricing
View Details
2-Chloroadenosine triphosphate Ammonium Salt (~90%)
TRC-C364109-1MG 1 mg

2-Chloroadenosine triphosphate Ammonium Salt (~90%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504496 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details