Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77XR9

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/220/1997 H5N1 genotype Gs/Gd)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETLTRNGWGCRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAMEF14 (NM_001099854) Human Over-expression Lysate
LC420543 20 µg

PRAMEF14 (NM_001099854) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB616490 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1), CF740 conjugate, 0.1mg/mL
BNC740448-100 1x 100 µL

TTF-1 / NKX2.1 (8G7G3/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSRB2 (NM_012228) Human Recombinant Protein
TP315002M 100 µg

MSRB2 (NM_012228) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF237 (ZMYM5) (NM_001142684) Human Over-expression Lysate
LC428247 20 µg

ZNF237 (ZMYM5) (NM_001142684) Human Over-expression Lysate

Sign In for Pricing
View Details
22,23-Dihydrospinasterol
TRC-D965120-25MG 25 mg

22,23-Dihydrospinasterol

Sign In for Pricing
View Details