Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77IM6

Expression Region

1-97

Origin

Influenza A virus (strain A/Hong Kong/1/1968 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnfaip8l1 Mouse shRNA Plasmid (Locus ID 66443)
TR503634 1 Kit

Tnfaip8l1 Mouse shRNA Plasmid (Locus ID 66443)

Sign In for Pricing
View Details
Mouse Monoclonal CD7 Antibody (T3-3A1) [DyLight 680]
NBP2-54901FR 0.1 mL

Mouse Monoclonal CD7 Antibody (T3-3A1) [DyLight 680]

Sign In for Pricing
View Details
Rabbit Anti-Human RGS12 Polyclonal Antibody
PA88048HU-01 50 µg

Rabbit Anti-Human RGS12 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human RGS12 Polyclonal Antibody
PA88048HU-02 100 µg

Rabbit Anti-Human RGS12 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human RGS12 Polyclonal Antibody
PA88048HU-03 500 µg

Rabbit Anti-Human RGS12 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human RGS12 Polyclonal Antibody
PA88048HU-04 1 mg

Rabbit Anti-Human RGS12 Polyclonal Antibody

Sign In for Pricing
View Details