Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P67866

Expression Region

1-97

Origin

Influenza A virus (strain A/Leningrad/134/17/1957 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCNYRFFKHGLK RGASTEGVPESMREEYRKEQQSAVDTDDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RPL11 Antibody [Janelia Fluor 549]
NBP2-22283JF549 0.1 mL

Rabbit Polyclonal RPL11 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant HPV-1a E7 (aa 1-93) Protein
VAng-Wyb3081-1mgEcoli 1 mg (E. coli)

Recombinant HPV-1a E7 (aa 1-93) Protein

Sign In for Pricing
View Details
CMTM7 (CKLFSF7, CKLF-like MARVEL Transmembrane Domain-containing Protein 7, Chemokine-like Factor Superfamily Member 7, FLJ30992) (MaxLight 650)
125116-ML650 100 µL

CMTM7 (CKLFSF7, CKLF-like MARVEL Transmembrane Domain-containing Protein 7, Chemokine-like Factor Superfamily Member 7, FLJ30992) (MaxLight 650)

Sign In for Pricing
View Details
Monkey C4 Binding Protein (C4BP) ELISA Kit
YP-W70945-01 48 Tests

Monkey C4 Binding Protein (C4BP) ELISA Kit

Sign In for Pricing
View Details
Monkey C4 Binding Protein (C4BP) ELISA Kit
YP-W70945-02 96 Tests

Monkey C4 Binding Protein (C4BP) ELISA Kit

Sign In for Pricing
View Details
Naca AAV siRNA Pooled Vector
31386164 1.0 µg

Naca AAV siRNA Pooled Vector

Sign In for Pricing
View Details