Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P67866

Expression Region

1-97

Origin

Influenza A virus (strain A/Leningrad/134/17/1957 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCNYRFFKHGLK RGASTEGVPESMREEYRKEQQSAVDTDDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adcy7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6716106 1.0 µg DNA

Adcy7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Slco6c1 (NM_028942) Mouse Tagged ORF Clone Lentiviral Particle
MR212712L4V 200 µL

Slco6c1 (NM_028942) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Clozapine N-oxide
LKT-C4759-M025 25 mg

Clozapine N-oxide

Sign In for Pricing
View Details
FTL Mouse Monoclonal Antibody
AMM81374-01 1 Each

FTL Mouse Monoclonal Antibody

Sign In for Pricing
View Details
FTL Mouse Monoclonal Antibody
AMM81374-02 50 µL

FTL Mouse Monoclonal Antibody

Sign In for Pricing
View Details
FTL Mouse Monoclonal Antibody
AMM81374-03 100 µL

FTL Mouse Monoclonal Antibody

Sign In for Pricing
View Details