Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P10921

Expression Region

1-97

Origin

Influenza A virus (strain A/Fort Warren/1/1950 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM5 Human Gene Knockout Kit (CRISPR)
KN401668 1 Kit

MCM5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIP120B (CAND2) Rabbit Polyclonal Antibody
AP07562SU-N 50 µL

TIP120B (CAND2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pinacidil Monohydrate
SIH-563-50MG 50 mg

Pinacidil Monohydrate

Sign In for Pricing
View Details
3-phenyl-1H-pyrrole-2-carboxylic acid
TRC-P322343-50MG 50 mg

3-phenyl-1H-pyrrole-2-carboxylic acid

Sign In for Pricing
View Details
GPX4 Recombinant Rabbit monoclonal Antibody [JU11-31]
ET1706-45-50UL 50 µL

GPX4 Recombinant Rabbit monoclonal Antibody [JU11-31]

Sign In for Pricing
View Details
Cr (Creatinine) ELISA Kit
E-EL-0058-01 24 Tests

Cr (Creatinine) ELISA Kit

Sign In for Pricing
View Details