Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P10921

Expression Region

1-97

Origin

Influenza A virus (strain A/Fort Warren/1/1950 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF568 conjugate, 0.1mg/mL
BNC682332-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pentachlorophenyl Laurate
TRC-P267015-10MG 10 mg

Pentachlorophenyl Laurate

Sign In for Pricing
View Details
2,4,6-Tris(pentadecafluoroheptyl)-1,3,5-triazine
TRC-T896145-250MG 250 mg

2,4,6-Tris(pentadecafluoroheptyl)-1,3,5-triazine

Sign In for Pricing
View Details
L-Tyrosine-d4
TRC-T899978-50MG 50 mg

L-Tyrosine-d4

Sign In for Pricing
View Details
Mouse S1pr1 activation kit by CRISPRa
GA201174 1 Kit

Mouse S1pr1 activation kit by CRISPRa

Sign In for Pricing
View Details
Oleuropein, 75%
TRC-O532950-500MG 500 mg

Oleuropein, 75%

Sign In for Pricing
View Details