Recombinant Escherichia fergusonii Protein AaeX (aaeX)
This Recombinant Escherichia fergusonii Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.
Product Specifications
Product Name Alternative
Protein AaeX
UniProt
B7LRL7
Expression Region
1-67
Origin
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
T5010-09B-ML490 100 µL
Thioredoxin, NT (TRX, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP, TRDX, TRX1) (MaxLight 490) discontinued
Sign In for Pricing
View Details MBS644737-01 0.1 mg
IL36G (Interleukin-36 gamma, IL-1-related Protein 2, IL-1RP2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 Family Member 9, IL-1F9, Interleukin-1 Homolog 1, IL-1H1, IL1E, IL1F9, IL1H1, IL1RP2, UNQ2456/PRO5737)
Sign In for Pricing
View Details MBS644737-02 5x 0.1 mg
IL36G (Interleukin-36 gamma, IL-1-related Protein 2, IL-1RP2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 Family Member 9, IL-1F9, Interleukin-1 Homolog 1, IL-1H1, IL1E, IL1F9, IL1H1, IL1RP2, UNQ2456/PRO5737)
Sign In for Pricing
View Details