Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia fergusonii Protein AaeX (aaeX)

This Recombinant Escherichia fergusonii Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B7LRL7

Expression Region

1-67

Origin

Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-hsa-let-7i Virus
mh2755 250 µL

AdmiRa-hsa-let-7i Virus

Sign In for Pricing
View Details
HRP-conjugated Mouse anti Myc-Tag mAb
AE026-01 100 μL

HRP-conjugated Mouse anti Myc-Tag mAb

Sign In for Pricing
View Details
HRP-conjugated Mouse anti Myc-Tag mAb
AE026-02 200 μL

HRP-conjugated Mouse anti Myc-Tag mAb

Sign In for Pricing
View Details
HRP-conjugated Mouse anti Myc-Tag mAb
AE026-03 500 μL

HRP-conjugated Mouse anti Myc-Tag mAb

Sign In for Pricing
View Details
HRP-conjugated Mouse anti Myc-Tag mAb
AE026-04 1000 μL

HRP-conjugated Mouse anti Myc-Tag mAb

Sign In for Pricing
View Details
AMPH Polyclonal Antibody
MBS2517069-01 0.02 mL

AMPH Polyclonal Antibody

Sign In for Pricing
View Details