Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q7A6Q1

Expression Region

1-77

Origin

Staphylococcus aureus (strain N315)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gestonorone Capronate
TRC-G368285-2.5G 2.5 g

Gestonorone Capronate

Sign In for Pricing
View Details
OTUB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F7]
TA505204AM 100 µL

OTUB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F7]

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), Biotin conjugate, 0.1mg/mL
BNCB2618-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (KRTH/1076), CF640R conjugate, 0.1mg/mL
BNC401076-500 1x 500 µL

Cytokeratin, HMW (KRTH/1076), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Arachidonoyl-sn-glycero-3-phosphocholine
TRC-A624590-50MG 50 mg

1-Arachidonoyl-sn-glycero-3-phosphocholine

Sign In for Pricing
View Details
AKAP14 Human qPCR Primer Pair (NM_178813)
HP226427 200 Reactions

AKAP14 Human qPCR Primer Pair (NM_178813)

Sign In for Pricing
View Details